LaunchKit · 2026
Back to Skills

fastfold-ai-fold

Submits and manages FastFold protein folding jobs via the Jobs API.

0
0 downloads
by @juliocesar-io

Setup & Installation

openclaw skills install @juliocesar-io/fastfold-ai-fold

Or with the ClawHub CLI, for registry-managed skill folders outside a full OpenClaw workspace:

npx clawhub install fastfold-ai-fold

What This Skill Does

Manages protein structure prediction jobs through the FastFold Jobs API. Handles the full lifecycle: authenticate, submit a fold job, poll until complete, then retrieve CIF/PDB files, quality metrics, and 3D viewer links. Works with single proteins, multi-chain complexes, RNA, DNA, and ligand sequences.

The bundled scripts handle polling, error states, and result parsing so you don't have to write that boilerplate yourself.

When to use it

  • Folding a novel protein sequence to predict its 3D structure
  • Automating batch fold submissions and waiting for results in a script
  • Downloading CIF files from completed jobs for use in molecular visualization tools
  • Checking pTM and ipTM confidence scores after a multi-chain complex prediction
  • Getting a shareable FastFold viewer link for a completed fold job

Example Workflow

Here's how your AI assistant might use this skill in practice.

INPUT

User asks: Fold this protein sequence MALWMRLLPLLALLALWGPDPAAAFVNQHLCGSHLVEALYLVCGERGFFYTPKT and give me the viewer link

AGENT
  1. 1Check that FASTFOLD_API_KEY is set in the environment or .env file
  2. 2Run create_job.py with the sequence and a job name to POST to /v1/jobs
  3. 3Run wait_for_completion.py with the returned job ID, polling every 5 seconds until status is COMPLETED
  4. 4Run fetch_results.py to retrieve meanPLLDT, ptm_score, and artifact URLs
  5. 5Run get_viewer_link.py to build the FastFold cloud viewer URL
OUTPUT

Job completed with meanPLLDT 87.3, ptm_score 0.81. CIF available at the signed URL. Viewer: https://cloud.fastfold.ai/mol/new?from=jobs&job_id=<uuid>

Requirements

Accounts, API keys, or tools you or your AI assistant may need to set up while using this skill.

FASTFOLD_API_KEY — generate at https://cloud.fastfold.ai/api-keys